THESE COMPANIES ARE NOT AFFILIATED WITH KEYSTONE SYMPOSIA and are not authorized by Keystone Symposia to contact you.

These companies may tell you that the meeting is filling and seek to take your lodging reservation and obtain your credit card number.

, Director of Development, Email: [email protected], Phone: 1 970-262-2690 Click here for more information on Industry Support and Recognition Opportunities.

alpha amidating monooxygenase-88

CATALYTIC ACTIVITY: Peptidylglycine ascorbate O(2) = peptidyl(2-hydroxyglycine) dehydroascorbate H(2)O. SIMILARITY: In the N-terminal section; belongs to the copper type II ascorbate-dependent monooxygenase family. SEQUENCE CAUTION: Sequence=AAD01439.1; Type=Erroneous initiation; COPYRIGHT: Protein annotation is derived from the Uni Prot Consortium (

CATALYTIC ACTIVITY: Peptidylamidoglycolate = peptidyl amide glyoxylate. COFACTOR: Binds 2 copper ions per subunit; For the monoxygenase reaction. SUBCELLULAR LOCATION: Isoform 1: Membrane; Single-pass type I membrane protein. Distributed under the Creative Commons Attribution-No Derivs License.

lcl|BSEQ0004317|Peptidyl-glycine alpha-amidating monooxygenase MAGRVPSLLVLLVFPSSCLAFRSPLSVFKRFKETTRPFSNECLGTTRPVVPIDSSDFALD IRMPGVTPKQSDTYFCMSMRIPVDEEAFVIDFKPRASMDTVHHMLLFGCNMPSSTGSYWF CDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKD CSGVSLHLTRLPQPLIAGMYLMMSVDTVIPAGEKVVNSDISCHYKNYPMHVFAYRVHTHH LGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCVFTGEGRTEATH IGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFRTIPPEANIPIPVKSDMVMMHE HHKETEYKDKIPLLQQPKREEEEVLDQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESES DLVAEIANVVQKKDLGRSDAREGAEHERGNAILVRDRIHKFHRLVSTLRPPESRVFSLQQ PPPGEGTWEPEHTGDFHMEEALDWPGVYLLPGQVSGVALDPKNNLVIFHRGDHVWDGNSF DSKFVYQQIGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVALH QVFKLDPNNKEGPVLILGRSMQPGSDQNHFCQPTDVAVDPGTGAIYVSDGYCNSRIVQFS PSGKFITQWGEESSGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVR EIKHSSFGRNVFAISYIPGLLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKPVRKHFD MPHDIVASEDGTVYIGDAHTNTVWKFTLTEKLEHRSVKKAGIEVQEIKEAEAVVETKMEN KPTSSELQKMQEKQKLIKEPGSGVPVVLITTLLVIPVVVLLAIAIFIRWKKSRAFGDSEH KLETSSGRVLGRFRGKGSGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKEDDGSESEEE YSAPLPALAPSSSBifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides.

The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part.

We highly recommend that you not make a reservation with these companies or any other housing service!

These companies' representations to participants have been misleading.A process for the production of peptidylglycine α-amidating monooxygenase, comprising the steps of: culturing insect cells transfected with a recombinant baculovirus to which a DNA coding for the peptidylglycine α-amidating monooxygenase has been incorporated to produce the enzyme, and recovering the...A process for the production of peptidylglycine α-amidating monooxygenase, comprising the steps of: culturing insect cells transfected with a recombinant baculovirus to which a DNA coding for the peptidylglycine α-amidating monooxygenase has been incorporated to produce the enzyme, and recovering the enzyme from the culture; and a process for the production of a C-terminal α-amidating peptide, comprising converting a C-terminal glycine-extended peptide to a C-terminal α-amidating peptide using the enzyme prepared by the above process.Guillemin's chemist began concurring with these results in 1969, as NIH threatened to cut off funding for the project, leading both parties to return to work on synthesis.TRH is used clinically by intravenous injection (brand name Relefact TRH) to test the response of the anterior pituitary gland; this procedure is known as a TRH test.Then, this Gly is converted into an amide residue by a series of enzymes collectively known as peptidylglycine-alpha-amidating monooxygenase.